DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp6c

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_957299.1 Gene:ppp6c / 393980 ZFINID:ZDB-GENE-040426-949 Length:305 Species:Danio rerio


Alignment Length:285 Identity:148/285 - (51%)
Similarity:195/285 - (68%) Gaps:2/285 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLEL 76
            |.|:.||..|.... || |.::::||..:.|||:.|||:..:.:|..|||||||||.||..|...
Zfish     5 DLDKYVEIARQCKY-LP-ENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRT 67

  Fly    77 GGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSR 141
            ||.|.:..|:|:||.||||..|:|||..|.|||.:.|.:::|||||||.|..|:.||||:||.::
Zfish    68 GGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTK 132

  Fly   142 YGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWS 206
            ||:||.||.|.:|||:|.:||:||..|||||||||||::.||.:|:::|..|||..|...||:||
Zfish   133 YGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWS 197

  Fly   207 DPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYC 271
            ||::...||.||||.|.|||..|..||...|.:.||||||||..:|:::.|.:.|||:|||||||
Zfish   198 DPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYC 262

  Fly   272 YRCGNKAAILRLNAAGDYDFKVFEA 296
            |||||.|:|:........:.|:|.|
Zfish   263 YRCGNIASIMVFKDVNTREPKLFRA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 148/285 (52%)
MPP_superfamily 12..296 CDD:301300 147/283 (52%)
ppp6cNP_957299.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 148/285 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.