DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp2cab

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_957205.2 Gene:ppp2cab / 393885 ZFINID:ZDB-GENE-040426-877 Length:309 Species:Danio rerio


Alignment Length:309 Identity:148/309 - (47%)
Similarity:200/309 - (64%) Gaps:13/309 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLEL 76
            :.|:.:|.|..  .:...|.:|:.||....::|..|||:..::.|..||||:||||.||:.|..:
Zfish     9 ELDQWIEQLNE--CKQLSETQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRI 71

  Fly    77 GGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSR 141
            ||...:..|||:||.||||..||||..||.|||||:..:|::||||||.|..|:.||||:|||.:
Zfish    72 GGKSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRERVTILRGNHESRQITQVYGFYDECLRK 136

  Fly   142 YGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWS 206
            ||:||||:....:||.|||.|::||.|.|:||||||.:..||.:|:|||..|:|..|.:.|||||
Zfish   137 YGNANVWKFFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWS 201

  Fly   207 DPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYC 271
            ||.:..||..||||.|..||.|:.|.|..|||::|:.|||||..:|:.|...:.:|||:||||||
Zfish   202 DPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYC 266

  Fly   272 YRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPK----KRCRQFF 316
            |||||:|||:.|:....|.|..|:       |.||:.:    :|...:|
Zfish   267 YRCGNQAAIMELDDTLKYSFLQFD-------PAPRRGEPHVTRRTPDYF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 145/294 (49%)
MPP_superfamily 12..296 CDD:301300 143/283 (51%)
ppp2cabNP_957205.2 MPP_PP2A_PP4_PP6 9..293 CDD:277360 144/292 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.