DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PpN58A

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:305 Identity:124/305 - (40%)
Similarity:170/305 - (55%) Gaps:27/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSALCPEAMN-----------DADRLVENLR---------HVPVRLPRELEVRQLCRSLSDLLV 45
            ||..|.....|           :.|:::..|:         .:.||     |:..:|....::|:
  Fly     1 MMKKLLSNGSNKNKTLKFDEGINLDQIIAKLKLIGEIGSVVQISVR-----EIEAVCSRAREVLL 60

  Fly    46 GESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKV 110
            .:..||.:.:|..:.||||||:.:||...|..|...:..||.|||.|||||.|:||..||.|||.
  Fly    61 KQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKA 125

  Fly   111 RHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGL 175
            |:|.:..||||||||.|....||||:||..|| :..:||.....::.|||||||:.||.|.||||
  Fly   126 RYPTKFYLLRGNHECSSINHFYGFYDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGL 189

  Fly   176 SPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQ-EAPGWAASPRGHGKLFGGDVVEEFTRANGI 239
            ||.:..:..:|.:.|..||||||:|.|:|||||. ...||..:.||....||.|||..|.....:
  Fly   190 SPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKL 254

  Fly   240 SLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            :||||.||:.:||:.:...:.|:||:||||||....|..|::.:|
  Fly   255 NLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCIN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 120/283 (42%)
MPP_superfamily 12..296 CDD:301300 120/283 (42%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 120/284 (42%)
MPP_superfamily 23..311 CDD:301300 120/283 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.