DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and gsp-2

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001022616.1 Gene:gsp-2 / 3564807 WormBaseID:WBGene00001748 Length:333 Species:Caenorhabditis elegans


Alignment Length:307 Identity:127/307 - (41%)
Similarity:184/307 - (59%) Gaps:16/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EAMNDADRLVENLRHVPVRLP------RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQ 66
            |.:| .|.::..|..|....|      .|.|::.||:...::.:.:..||.|::|..:|||:|||
 Worm     4 EKLN-LDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQ 67

  Fly    67 FEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRS 131
            :.|||.|.|.||...|..||||||.|||||.|:||..||.|.|:::|....||||||||.|..|.
 Worm    68 YYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRI 132

  Fly   132 YGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPE 196
            ||||:||..|| :..:|:.....|:.||:|||||..|.|.|||||||:|.::.:|.:.|..::|:
 Worm   133 YGFYDECKRRY-NIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD 196

  Fly   197 SGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQL 260
            .|::.||||||| ::..||..:.||....||.:||.:|...:.:.|||||||:.:||:.:...:.
 Worm   197 QGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ 261

  Fly   261 LVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK 307
            |||::||||||....|..:::.::......|::.       ||..:|
 Worm   262 LVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQIL-------KPADKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 124/301 (41%)
MPP_superfamily 12..296 CDD:301300 122/290 (42%)
gsp-2NP_001022616.1 PTZ00480 5..315 CDD:185658 126/306 (41%)
MPP_PP1_PPKL 7..297 CDD:277359 123/298 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.