DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Pp2B-14D

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster


Alignment Length:340 Identity:125/340 - (36%)
Similarity:173/340 - (50%) Gaps:51/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AMNDADRLVENLRHVPVR-------------------------LPRELEVRQLCRSLSD---LLV 45
            |:|..:|:|:::...|..                         |...:|.....:.:.|   ||.
  Fly    75 AVNTKERVVDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLR 139

  Fly    46 GESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKV 110
            .|..::.:::|..|||||||||.||:.|.|:|||....:||||||.||||..|:|..|.|.:||:
  Fly   140 QEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKI 204

  Fly   111 RHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGL 175
            .:|..:.|||||||||..|..:.|.:||..:| |..|:..|...||.|||||:::...|||||||
  Fly   205 TYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVHGGL 268

  Fly   176 SPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPG--------WAASPRGHGKLFGGDVVEE 232
            ||::..|:|:|.|||..|.|..|.:.|||||||.|..|        ...|.||....:......:
  Fly   269 SPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCD 333

  Fly   233 FTRANGISLICRAHQLAQDGFRWH-------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYD 290
            |.:.|.:..|.|||:....|:|.:       |.. |:||:|||||.....||||:|:      |:
  Fly   334 FLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS-LITIFSAPNYLDVYNNKAAVLK------YE 391

  Fly   291 FKVFEAQALHSKPQP 305
            ..|...:..:..|.|
  Fly   392 NNVMNIRQFNCSPHP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 123/337 (36%)
MPP_superfamily 12..296 CDD:301300 121/326 (37%)
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 120/308 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438866
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.