DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppef1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:322 Identity:91/322 - (28%)
Similarity:154/322 - (47%) Gaps:50/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEAMNDADRLVENLR-----HVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQI-VCGDIHG 65
            |....|.:.|::..:     |....|....|.|::.:.:.:.    :.:.:..:.:| :|||:||
  Rat   140 PLTFTDINLLLQAFKQQQTLHAHYVLEVLFEARKILKQMPNF----TRIQTFPAKEITICGDLHG 200

  Fly    66 QFEDLLHLLELGGSVQE-HRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSAT 129
            :.:||:.:....|...| :.|:|.||.||||.||:|..::|....:.:|..:.|.|||||.....
  Rat   201 KLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMN 265

  Fly   130 RSYGFYEECLSRY--GSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDR-- 190
            ..|||.:|.|.:|  ....:.::...::..||:..|||..||.:|||:| :...|:.|:.|.|  
  Rat   266 LRYGFTKEILQKYKLHGKKILQVLEELYTWLPIGTIIDNEILVIHGGIS-ESTDLNILQQLQRNK 329

  Fly   191 --------------CH-EIPESG----------------IIADLLWSDPQEAPG-WAASPRGHGK 223
                          |: :..::|                .|.|||||||:...| :..:.||.|.
  Rat   330 MKSVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGC 394

  Fly   224 LFGGDVVEEFTRANGISLICRAHQLAQDGFR-WHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            .||.||..:....|.:.::.|:|:...||:. .|.|: ::|::||.||.....|:.|.:||:
  Rat   395 YFGPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGK-VITVFSASNYYEEGSNRGAYIRLS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 90/317 (28%)
MPP_superfamily 12..296 CDD:301300 90/317 (28%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 91/322 (28%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.