DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and PpV

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster


Alignment Length:309 Identity:153/309 - (49%)
Similarity:206/309 - (66%) Gaps:9/309 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLL 74
            |.|.|:.:|:::.... || |.|:::||..:.|:|:.|:|:|.:.:|..|||||||||.||..|.
  Fly     1 MGDVDKWIEDVKKCKY-LP-ENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLF 63

  Fly    75 ELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECL 139
            ..||.|....|:|:||.||||..|:|||..|..||.|:|::::|||||||.|..|:.|||::||.
  Fly    64 RTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECF 128

  Fly   140 SRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLL 204
            |:||:||.|:.||:|||||.:|||||..:|||||||||::..||.:|::||..|||..|...||:
  Fly   129 SKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLV 193

  Fly   205 WSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPN 269
            ||||::...|..||||.|.|||.:|.::|...|.::||||||||..:|.::.|...|||:|||||
  Fly   194 WSDPEDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPN 258

  Fly   270 YCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK--PKKRCRQFF 316
            |||||||.||||....|.....|:|.|     .|...:  ||:....:|
  Fly   259 YCYRCGNVAAILSFETAEKRQTKIFLA-----VPDAERVIPKQNTTPYF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 149/294 (51%)
MPP_superfamily 12..296 CDD:301300 147/283 (52%)
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 152/307 (50%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 148/290 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45619
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.