DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_037197.1 Gene:Ppp1cb / 25594 RGDID:3376 Length:327 Species:Rattus norvegicus


Alignment Length:322 Identity:133/322 - (41%)
Similarity:190/322 - (59%) Gaps:23/322 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHV----PVRLPR--ELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDL 70
            :.|.|:..|..|    |.::.:  |.|||.||....::.:.:..||.|::|..:|||||||:.||
  Rat     7 NVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDL 71

  Fly    71 LHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFY 135
            |.|.|.||...|..||||||.|||||.|:||..||.|.|:::|....||||||||.|..|.||||
  Rat    72 LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 136

  Fly   136 EECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGII 200
            :||..|: :..:|:.....|:.||:|||:|..|.|.|||||||:|.::.:|.:.|..::|::|::
  Rat   137 DECKRRF-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 200

  Fly   201 ADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTI 264
            .||||||| ::..||..:.||....||.|||.:|...:.:.|||||||:.:||:.:...:.|||:
  Rat   201 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 265

  Fly   265 WSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQ------------PR---KPKKR 311
            :||||||....|...::.::......|::.:.....:|.|            ||   .||||
  Rat   266 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 129/316 (41%)
MPP_superfamily 12..296 CDD:301300 125/290 (43%)
Ppp1cbNP_037197.1 MPP_PP1_PPKL 7..297 CDD:277359 125/290 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.