DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and SPAC22H10.04

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_593740.1 Gene:SPAC22H10.04 / 2541444 PomBaseID:SPAC22H10.04 Length:307 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:143/311 - (45%)
Similarity:191/311 - (61%) Gaps:9/311 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLL 74
            |.|.|.::|.|  ...:|..|..:..||....::|:.|||::.|.:|..|.|||||||:|||.:.
pombe     1 MIDLDNIIERL--YEKQLIAESVIAYLCSLAKEVLMQESNVVRLSTPITVVGDIHGQFDDLLEIF 63

  Fly    75 ELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECL 139
            .:||......||||||.||||..|:||..||..||:|:|.:::|||||||.|..|::||||.|||
pombe    64 RIGGPCPYTNYLFLGDYVDRGYYSIETITLLICLKLRYPKRITLLRGNHESRGITQTYGFYSECL 128

  Fly   140 SRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLL 204
            .:||:||||:....:||.|.|:|.||..|.||||||||.:|.:|.:..|||..|.|..|.:|||:
pombe   129 RKYGNANVWKYFTDIFDFLTLSATIDDTIFCVHGGLSPSIQHIDQILVLDRFREFPHEGPMADLV 193

  Fly   205 WSDP----QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIW 265
            ||||    ||   ::.||||.|..||..:|.:|...|.:..|.|||||..:|::..|.:.|.|:|
pombe   194 WSDPDPSVQE---FSLSPRGAGFSFGEVIVTKFLEYNNMKHILRAHQLCSEGYQILFEKKLSTVW 255

  Fly   266 SAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPKKRCRQFF 316
            |||||||||.|.|:||:::......|.||:|......|......|...::|
pombe   256 SAPNYCYRCANLASILQIDTDQSRFFNVFDAAPNQETPFVEPAAKVTAEYF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 140/298 (47%)
MPP_superfamily 12..296 CDD:301300 138/287 (48%)
SPAC22H10.04NP_593740.1 MPP_PP2A_PP4_PP6 3..288 CDD:277360 139/289 (48%)
PP2Ac 17..288 CDD:197547 134/273 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.