DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and SPBC26H8.05c

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_596646.1 Gene:SPBC26H8.05c / 2540680 PomBaseID:SPBC26H8.05c Length:348 Species:Schizosaccharomyces pombe


Alignment Length:345 Identity:158/345 - (45%)
Similarity:203/345 - (58%) Gaps:52/345 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDAD-----RLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFED 69
            |.|.|     ..:||.|.:|     |..|.:||:.:.|:|:.|||:..:.||..:|||||||..|
pombe     1 MTDLDLDWQLEELENGRLIP-----ESNVVELCQRVRDILIEESNIQWISSPVTICGDIHGQLHD 60

  Fly    70 LLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGF 134
            ||.|..:|||....:||||||.||||..||||||||..||.::|.:::|:|||||.|..|:.|||
pombe    61 LLELFRIGGSCPGTKYLFLGDFVDRGFYSVETFLLLLTLKCKYPKEMTLIRGNHESRQITQVYGF 125

  Fly   135 YEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGI 199
            |:||:.:||||||||.||.:||.|.|.|::||.:.||||||||.:..:|.:|.|||..|:|..|.
pombe   126 YDECVRKYGSANVWRYCCEIFDYLSLGALVDGKVFCVHGGLSPSISSIDQIRLLDRKQEVPHEGA 190

  Fly   200 IADLLWSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHF------- 257
            :.|||||||::..||..||||.|.|||.||.|.|.|||.:|.|.|||||..:|::.||       
pombe   191 MCDLLWSDPEDISGWGLSPRGAGFLFGADVSEVFNRANDLSFIARAHQLVMEGYKIHFSDKDKQY 255

  Fly   258 -------------------------GQLL----------VTIWSAPNYCYRCGNKAAILRLNAAG 287
                                     |.::          ||:||||||||||||.|:||:|:...
pombe   256 PKFTNEEDSELDSDSASPVDDSPAPGDIITIPEKDKGSVVTVWSAPNYCYRCGNVASILQLDENQ 320

  Fly   288 DYDFKVFEAQALHSKPQPRK 307
            ...||:|...:......|.|
pombe   321 TQSFKIFGTASQERSGIPTK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 156/341 (46%)
MPP_superfamily 12..296 CDD:301300 155/330 (47%)
SPBC26H8.05cNP_596646.1 PTZ00239 4..348 CDD:173488 156/342 (46%)
MPP_PP2A_PP4_PP6 5..330 CDD:277360 154/329 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.