DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:320 Identity:133/320 - (41%)
Similarity:189/320 - (59%) Gaps:25/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPR-------------ELEVRQLCRSLSDLLVGESNLLSLQSPQIVCG 61
            |:|:::|  ||..:..||..             |.|:|.||....::.:.:..||.|::|..:||
  Rat     1 MSDSEKL--NLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICG 63

  Fly    62 DIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECR 126
            |||||:.|||.|.|.||...|..||||||.|||||.|:||..||.|.|:::|....||||||||.
  Rat    64 DIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECA 128

  Fly   127 SATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRC 191
            |..|.||||:||..|| :..:|:.....|:.||:|||:|..|.|.|||||||:|.::.:|.:.|.
  Rat   129 SINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRP 192

  Fly   192 HEIPESGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRW 255
            .::|:.|::.||||||| ::..||..:.||....||.:||.:|...:.:.|||||||:.:||:.:
  Rat   193 TDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEF 257

  Fly   256 HFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPKKRCRQF 315
            ...:.|||::||||||....|..|::.::......|::.       ||.. |.|.:..||
  Rat   258 FAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQIL-------KPAD-KNKGKYGQF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 128/308 (42%)
MPP_superfamily 12..296 CDD:301300 126/297 (42%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 124/297 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.