DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppef1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_011246120.1 Gene:Ppef1 / 237178 MGIID:1097157 Length:676 Species:Mus musculus


Alignment Length:314 Identity:86/314 - (27%)
Similarity:144/314 - (45%) Gaps:52/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQI-VCGDIHGQFEDLLHLLELGGSVQ 81
            :.:.|....|....|.|::.:.:.:.    |::.:..:.:| :|||:||:.:||:.:....|...
Mouse   160 QQILHAHYVLEVLFEARKVLKQMPNF----SHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPS 220

  Fly    82 EHR-YLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRY--G 143
            |:. |:|.||.||||.||:|..::|....:.:|:.:.|.|||||.......|||.:|.|.:|  .
Mouse   221 ENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLH 285

  Fly   144 SANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDR------------------ 190
            ...:.::...|:..||:..|||..||.:|||:| :...|:.|..|.|                  
Mouse   286 GRKILQVLEEVYTWLPIGTIIDNEILVIHGGIS-ESTDLNTLHQLQRNKMKSVLMPPVLGNQETG 349

  Fly   191 -----------------CHEIPESGI-------IADLLWSDPQEAPG-WAASPRGHGKLFGGDVV 230
                             ..:.|...:       |.|:|||||:...| :..:.||.|..||.||.
Mouse   350 EKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVT 414

  Fly   231 EEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            .:....|.:.::.|:|:...||:.......::|::||.||.....|:.|.:||:
Mouse   415 SKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 86/314 (27%)
MPP_superfamily 12..296 CDD:301300 86/314 (27%)
Ppef1XP_011246120.1 MPP_RdgC 144..479 CDD:277364 86/314 (27%)
PTZ00183 518..660 CDD:185503
EF-hand_7 595..663 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.