DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp3cb

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006518770.1 Gene:Ppp3cb / 19056 MGIID:107163 Length:534 Species:Mus musculus


Alignment Length:321 Identity:130/321 - (40%)
Similarity:177/321 - (55%) Gaps:29/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LCPEAMNDADRL--VENLRHVPV---RLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIH 64
            |..|.:.|.|.:  |:.|::..|   |:..|:.:| :....:.:|..|..::.:::|..||||||
Mouse    38 LTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALR-IINEGAAILRREKTMIEVEAPITVCGDIH 101

  Fly    65 GQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSAT 129
            |||.||:.|.|:|||....|||||||.||||..|:|..|.|..||:.:|:.:.|||||||||..|
Mouse   102 GQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLT 166

  Fly   130 RSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEI 194
            ..:.|.:||..:| |..|:..|...||.|||||:::...|||||||||::..|||:|.|||..|.
Mouse   167 EYFTFKQECKIKY-SERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEP 230

  Fly   195 PESGIIADLLWSDPQEAPGWAASP--------RGHGKLFGGDVVEEFTRANGISLICRAHQLAQD 251
            |..|.:.|||||||.|..|...|.        ||....:....|.||.:.|.:..|.|||:....
Mouse   231 PAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDA 295

  Fly   252 GFRWH-------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQP 305
            |:|.:       |.. |:||:|||||.....||||:|:      |:..|...:..:..|.|
Mouse   296 GYRMYRKSQTTGFPS-LITIFSAPNYLDVYNNKAAVLK------YENNVMNIRQFNCSPHP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 128/314 (41%)
MPP_superfamily 12..296 CDD:301300 126/303 (42%)
Ppp3cbXP_006518770.1 MPP_PP2B 50..354 CDD:277361 126/309 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.