DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp3ca

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_032939.1 Gene:Ppp3ca / 19055 MGIID:107164 Length:521 Species:Mus musculus


Alignment Length:313 Identity:130/313 - (41%)
Similarity:172/313 - (54%) Gaps:27/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NDADRLVENLR-HV--PVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLH 72
            ||....|:.|: |:  ..||...:.:|.:....| :|..|.|||.:.:|..|||||||||.||:.
Mouse    37 NDGKPRVDILKAHLMKEGRLEESVALRIITEGAS-ILRQEKNLLDIDAPVTVCGDIHGQFFDLMK 100

  Fly    73 LLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEE 137
            |.|:|||....|||||||.||||..|:|..|.|.|||:.:|..:.|||||||||..|..:.|.:|
Mouse   101 LFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQE 165

  Fly   138 CLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIAD 202
            |..:| |..|:..|...||.|||||:::...|||||||||::..|||:|.|||..|.|..|.:.|
Mouse   166 CKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCD 229

  Fly   203 LLWSDPQEAPGWAASP--------RGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWH--- 256
            :|||||.|..|...:.        ||....:....|.:|.:.|.:..|.|||:....|:|.:   
Mouse   230 ILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKS 294

  Fly   257 ----FGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQP 305
                |.. |:||:|||||.....||||:|:      |:..|...:..:..|.|
Mouse   295 QTTGFPS-LITIFSAPNYLDVYNNKAAVLK------YENNVMNIRQFNCSPHP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 129/312 (41%)
MPP_superfamily 12..296 CDD:301300 127/301 (42%)
Ppp3caNP_032939.1 MPP_PP2B 41..345 CDD:277361 128/309 (41%)
Catalytic. /evidence=ECO:0000305 56..340 123/292 (42%)
SAPNY motif. /evidence=ECO:0000250|UniProtKB:Q08209 307..311 3/3 (100%)
Interaction with PxIxIF motif in substrate. /evidence=ECO:0000250|UniProtKB:Q08209 327..336 1/8 (13%)
Calcineurin B binding. /evidence=ECO:0000269|PubMed:26794871 341..369 130/313 (42%)
Calmodulin-binding. /evidence=ECO:0000269|PubMed:26794871 392..406
Autoinhibitory segment. /evidence=ECO:0000269|PubMed:26794871 407..414
Autoinhibitory domain. /evidence=ECO:0000269|PubMed:26794871 465..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.