DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006530263.1 Gene:Ppp1cc / 19047 MGIID:104872 Length:337 Species:Mus musculus


Alignment Length:311 Identity:131/311 - (42%)
Similarity:187/311 - (60%) Gaps:14/311 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRL-----VENLRHVPVRLP------RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDI 63
            |.|.|:|     ::.|..|....|      :|.|:|.||....::.:.:..||.|::|..:||||
Mouse     1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65

  Fly    64 HGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSA 128
            |||:.|||.|.|.||...|..||||||.|||||.|:||..||.|.|:::|....||||||||.|.
Mouse    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130

  Fly   129 TRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHE 193
            .|.||||:||..|| :..:|:.....|:.||:|||:|..|.|.|||||||:|.::.:|.:.|..:
Mouse   131 NRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTD 194

  Fly   194 IPESGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHF 257
            :|:.|::.||||||| ::..||..:.||....||.:||.:|...:.:.|||||||:.:||:.:..
Mouse   195 VPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA 259

  Fly   258 GQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKP 308
            .:.|||::||||||....|..|::.::......|::.: .|...||...:|
Mouse   260 KRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILK-PAEKKKPNATRP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 129/306 (42%)
MPP_superfamily 12..296 CDD:301300 126/295 (43%)
Ppp1ccXP_006530263.1 MPP_PP1_PPKL 8..298 CDD:277359 123/291 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.