DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and T25B9.2

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_501992.2 Gene:T25B9.2 / 188880 WormBaseID:WBGene00012008 Length:343 Species:Caenorhabditis elegans


Alignment Length:337 Identity:114/337 - (33%)
Similarity:166/337 - (49%) Gaps:59/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGG---SVQE----------- 82
            |:.:||....:|:..|...|.|::|..|.|||||||:|||.:|::.|   |.||           
 Worm     8 ELAELCHRARELIWSEPIFLKLEAPICVMGDIHGQFDDLLAMLDMNGWPLSSQEFEALKDITVRS 72

  Fly    83 ----------------------------------------HRYLFLGDLVDRGKNSVETFLLLAA 107
                                                    .|||||||.||||..|:|..:||.|
 Worm    73 RETGKRPQSEPHSTQPESSNDVKPPVAAPKSVNKEVTTGYKRYLFLGDYVDRGPFSMEVVILLTA 137

  Fly   108 LKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVH 172
            ||:.:|.::.|||||||.||...|||||.|...|| .|.::.....:|::.|..|:|:..|:|:|
 Worm   138 LKLAYPDRIYLLRGNHESRSVNTSYGFYREVNYRY-DAQLYECFQNMFNVFPFCAVINNTIMCMH 201

  Fly   173 GGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEA-PGWAASPRGHGKLFGGDVVEEFTRA 236
            ||:|..:...:......|..|||:.|::.||.|:||... .|:..|.||...:||...:..|.:.
 Worm   202 GGISEHLTSFNQFSVFKRPLEIPDVGVLTDLTWADPDPTEKGYKPSARGASFVFGPPALRAFLKK 266

  Fly   237 NGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHS 301
            ..:.::.|.||:.:||:.:..|:.||||:||||||.:..|.||:..::........||..::...
 Worm   267 LDLQMVIRGHQVVEDGYEFFDGRRLVTIFSAPNYCGQNDNTAAVFSIDKKLKISINVFRPESRDK 331

  Fly   302 K---PQPRKPKK 310
            |   .:.||.||
 Worm   332 KRGFEKERKAKK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 110/332 (33%)
MPP_superfamily 12..296 CDD:301300 109/318 (34%)
T25B9.2NP_501992.2 PP2Ac 4..328 CDD:197547 109/320 (34%)
MPP_superfamily 7..326 CDD:301300 109/318 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.