DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and R08A2.2

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_506632.2 Gene:R08A2.2 / 187692 WormBaseID:WBGene00011133 Length:371 Species:Caenorhabditis elegans


Alignment Length:259 Identity:98/259 - (37%)
Similarity:145/259 - (55%) Gaps:14/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPA 114
            :|.::.|..:.||||||.:.|:...:..|...:.::|||||.||||..|.|..|||...|:|:|.
 Worm    58 MLQVEHPITIVGDIHGQLDALIRYFDAVGYPPKVKFLFLGDYVDRGAKSFEVSLLLFCYKIRYPH 122

  Fly   115 QVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDM 179
            .|.||||||||....|.|||||| |:|.....:||....||:.|||.|.:...|||:|||:|.:.
 Worm   123 SVHLLRGNHECMKMNRLYGFYEE-LARKRGGRMWRQYQNVFNELPLCARVGQRILCMHGGISQNC 186

  Fly   180 QRLDDLRSLDR------CHEIPESGIIADLLWSDP-QEAPGWAA--SPRGHGKLFGGDVVEEFTR 235
            ...:..::|.:      |.|    |:..||:|:|| |:.....|  ..|....:||...::.|.:
 Worm   187 NSWESFKALKKPNTPLTCDE----GLQVDLMWADPTQDKCNTFAMNKQRAISVVFGEKGLDVFLK 247

  Fly   236 ANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQAL 299
            ..|:|||.|||:::|:||.:.|.:..||::|||.||....|..||:.::.:.:..|.|...:.:
 Worm   248 KLGLSLIVRAHEVSQEGFNFLFNKKCVTVFSAPYYCGNDTNCGAIMHVSESYEISFTVLRPRMI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 98/259 (38%)
MPP_superfamily 12..296 CDD:301300 98/254 (39%)
R08A2.2NP_506632.2 PP2Ac 36..308 CDD:197547 98/254 (39%)
MPP_PPP_family 66..295 CDD:277316 94/233 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.