DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and F23B12.1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_506574.3 Gene:F23B12.1 / 184887 WormBaseID:WBGene00009079 Length:329 Species:Caenorhabditis elegans


Alignment Length:292 Identity:117/292 - (40%)
Similarity:174/292 - (59%) Gaps:19/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AMNDADR-LVENLRHVPV------------RLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVC 60
            |.||..: .|:|..|..:            :|..|.|:.:||....:........|.:::|..:|
 Worm    17 AGNDVQKNKVQNWLHSVIERLKWWSPGRCQQLFVENELIELCYRAREQFWKNKVKLDIEAPVKIC 81

  Fly    61 GDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHEC 125
            ||||||||||:.|.||.|..:||:||||||.||||..|:|...||...::..|.:|.|||||||.
 Worm    82 GDIHGQFEDLMALFELNGWPEEHKYLFLGDYVDRGPFSIEVITLLFTFQILMPDKVFLLRGNHES 146

  Fly   126 RSATRSYGFYEECLSRYGSA--NVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSL 188
            |.....||||.||..||..|  :.:::   .|:.:||.|::...|:|:|||:|.|:..|..|..:
 Worm   147 RPVNMQYGFYLECKKRYSVALYDAFQL---AFNCMPLCAVVSKKIICMHGGISEDLIDLTQLEKI 208

  Fly   189 DRCHEIPESGIIADLLWSDPQEAP-GWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDG 252
            ||..:||:.|:|:||.|:||.|.. |:|.||||.|:.||.:.|::|.:.:.:.|:.||||:..||
 Worm   209 DRPFDIPDIGVISDLTWADPDEKVFGYADSPRGAGRSFGPNAVKKFLQMHNLDLVVRAHQVVMDG 273

  Fly   253 FRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            :.:...:.|||::|||:||.:..|.||::.::
 Worm   274 YEFFADRQLVTVFSAPSYCGQFDNAAAVMNVD 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 115/289 (40%)
MPP_superfamily 12..296 CDD:301300 115/289 (40%)
F23B12.1NP_506574.3 PP2Ac 51..317 CDD:197547 110/258 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.