DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and F22D6.9

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_492012.1 Gene:F22D6.9 / 184829 WormBaseID:WBGene00009054 Length:368 Species:Caenorhabditis elegans


Alignment Length:306 Identity:114/306 - (37%)
Similarity:167/306 - (54%) Gaps:44/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HV--PVR---LPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGG--- 78
            ||  ||.   :.:..|:.:||....:|...:.....::.|..:.||||||||||..::::.|   
 Worm    34 HVWSPVNCQDMLKRYEIYELCLRARELFWTQPLYRHVEVPVTIVGDIHGQFEDLKMMMDMNGWPF 98

  Fly    79 ----------------------------------SVQEHRYLFLGDLVDRGKNSVETFLLLAALK 109
                                              ...:..||||||.||||..|:|..|:|.|:.
 Worm    99 TEDEAKEMCKNLLLKGGKDGKQTFPAVLGSGTDRQKTQKNYLFLGDYVDRGPYSIEVVLMLFAMH 163

  Fly   110 VRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGG 174
            :|.|.:|:|||||||.|...|.||||.||:.|| |..::.:....|:.:||.||::..|:|:|||
 Worm   164 LRWPDRVTLLRGNHESRPVNRQYGFYGECVRRY-SERIYEVFQLAFNAMPLTAIVNKRIMCMHGG 227

  Fly   175 LSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQ-EAPGWAASPRGHGKLFGGDVVEEFTRANG 238
            :|.::..|..|.:|.|..:.|:.||||||.|:||: |...:..||||.||:||...|:||.:...
 Worm   228 ISEELFDLKQLDALKRPIDTPDIGIIADLTWADPECEIDYYKESPRGAGKIFGAKAVDEFCKHFQ 292

  Fly   239 ISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            :.||.||||:.|||:.:...:.||||:|||.||.:..|.|::|.::
 Worm   293 LDLIVRAHQVVQDGYEFFADRKLVTIFSAPFYCGQTNNIASMLNID 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 114/306 (37%)
MPP_superfamily 12..296 CDD:301300 114/306 (37%)
F22D6.9NP_492012.1 MPP_superfamily 25..350 CDD:301300 114/306 (37%)
PP2Ac 45..351 CDD:197547 110/295 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.