DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and C24H11.1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_499527.1 Gene:C24H11.1 / 182859 WormBaseID:WBGene00007699 Length:384 Species:Caenorhabditis elegans


Alignment Length:262 Identity:98/262 - (37%)
Similarity:155/262 - (59%) Gaps:14/262 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPA 114
            ||.||:|..:|||.|||:.|||.:....|:..:.:||||||.||||.:|:|..:||.:||:..|.
 Worm   107 LLELQAPINICGDTHGQYNDLLRIFNACGAATKTQYLFLGDYVDRGGHSLEVIMLLFSLKLAMPR 171

  Fly   115 QVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCC----RVFDLLPLAAIIDGNILCVHGGL 175
            ::.|||||||.::..::|||:.|...|:....|:....    :||..:||.||:...|||:|||:
 Worm   172 KMHLLRGNHELKAINKNYGFHAELKKRFQREEVYESVYNHFNQVFSYMPLCAIVSKRILCMHGGI 236

  Fly   176 SPDMQRLDDLRSLDRCHEIPESGIIA-DLLWSDPQ-EAPGWAASP-RGHGKLFGGDVVEEFTRAN 237
            ||.::.|||:|::....|..::..:| ||||:||: :|.|:..:. |....:||...|::..:..
 Worm   237 SPHLKSLDDIRAIPLPLETAKTHPLACDLLWADPEKDAKGFEPNKIRAISNVFGKKEVDDLCKRL 301

  Fly   238 GISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSK 302
            .|.||.||||:.:.|:.:...:.|:|::||..|.....|.||::.:|       |:.|...:..|
 Worm   302 DIDLIVRAHQVVEYGYAFFADRRLITVFSASRYQIELCNYAAVVVVN-------KMLELSFVQLK 359

  Fly   303 PQ 304
            |:
 Worm   360 PE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 98/262 (37%)
MPP_superfamily 12..296 CDD:301300 95/252 (38%)
C24H11.1NP_499527.1 MPP_superfamily 43..360 CDD:301300 96/259 (37%)
PP2Ac 106..360 CDD:197547 96/259 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.