DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and C25A6.1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_504432.3 Gene:C25A6.1 / 178923 WormBaseID:WBGene00016081 Length:300 Species:Caenorhabditis elegans


Alignment Length:267 Identity:112/267 - (41%)
Similarity:151/267 - (56%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLA 106
            |:...:.:::.:.:|..|||||||||.|||.|...||......||||||.||||:.|:||.:||.
 Worm    41 DVFKRQKSMVEMNAPIKVCGDIHGQFPDLLRLFHRGGWPPTANYLFLGDYVDRGRFSIETIVLLL 105

  Fly   107 ALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCV 171
            |.||:.|..:.||||||||....:.|||||||..||.|..::.....||:.|||..:|...|||:
 Worm   106 AYKVKFPGNLFLLRGNHECEFVNKVYGFYEECQKRYQSVRMFTAFQDVFNWLPLCGLIANKILCM 170

  Fly   172 HGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTR 235
            ||||||.             |:..|. ::|||||:|| ....|:..:.||.|..||.|.|.:...
 Worm   171 HGGLSPS-------------HDGKER-LVADLLWADPISGLSGFMENNRGAGCGFGRDAVLKVCS 221

  Fly   236 ANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQA-- 298
            ...:.|||||||:.|||:.:..|:.||||:|||:||.:..|.||.:..:......|::....:  
 Worm   222 DFKLDLICRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSCDEKLQCSFEILRPTSGR 286

  Fly   299 --LHSKP 303
              :..||
 Worm   287 LEVREKP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 112/267 (42%)
MPP_superfamily 12..296 CDD:301300 110/254 (43%)
C25A6.1NP_504432.3 MPP_superfamily 5..282 CDD:301300 110/254 (43%)
PP2Ac 32..284 CDD:197547 110/256 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.