DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and tax-6

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001367052.1 Gene:tax-6 / 177943 WormBaseID:WBGene00006527 Length:545 Species:Caenorhabditis elegans


Alignment Length:315 Identity:126/315 - (40%)
Similarity:169/315 - (53%) Gaps:32/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRLVENLRHVPV--------RLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDL 70
            ||.....||..:        |:..|..:| :.:..|.|...|..:|.:::|..|||||||||.||
 Worm    60 DRRTGKPRHEVLRDHFIKEGRIEEEAAIR-VIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDL 123

  Fly    71 LHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFY 135
            :.|.|:|||....:||||||.||||..|:|..|.|.|||:.:|..:.|||||||||..|..:.|.
 Worm   124 MKLFEVGGSPATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFK 188

  Fly   136 EECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGII 200
            :||..:| |..|:.:|...||.|||||:::...|||||||||::..|:|:|.:||..|.|..|.:
 Worm   189 QECKIKY-SERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPM 252

  Fly   201 ADLLWSDPQEAPGWAA--------SPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWH- 256
            .|||||||.|..|...        |.||....:......:|.:.|.:..|.|||:....|:|.: 
 Worm   253 CDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYR 317

  Fly   257 ------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQP 305
                  |.. |:||:|||||.....||||||:      |:..|...:..:..|.|
 Worm   318 KSQATGFPS-LITIFSAPNYLDVYNNKAAILK------YENNVMNIRQFNCSPHP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 126/315 (40%)
MPP_superfamily 12..296 CDD:301300 124/304 (41%)
tax-6NP_001367052.1 MPP_PP2B 66..370 CDD:277361 124/309 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.