DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and C23G10.1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001367544.1 Gene:C23G10.1 / 175880 WormBaseID:WBGene00016010 Length:454 Species:Caenorhabditis elegans


Alignment Length:271 Identity:101/271 - (37%)
Similarity:158/271 - (58%) Gaps:2/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVD 93
            |.:::.:|......:...:.:::.:..|..:|||:|||:.||:.|...||...:..||||||.||
 Worm   163 RTMDIFRLIHICKKIFTVQKSMVEIDGPVRICGDLHGQYPDLIRLFAQGGFPPDSNYLFLGDYVD 227

  Fly    94 RGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSAN--VWRMCCRVFD 156
            ||..::|..||..|.|.|:|....:||||||.......|||.:|..:|.|..:  ::.....:.|
 Worm   228 RGSFNLEVILLCLAYKARYPNNFMMLRGNHEVIHINEKYGFKDEVFNRKGEYHDELYPEFNEMMD 292

  Fly   157 LLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWAASPRGH 221
            ::||.|::.|.|||:|||||..::.|||||:|.|.....:..:..|::||||.:..||.|:|||.
 Worm   293 MMPLVALVGGRILCMHGGLSQHIKSLDDLRNLRRPFHSEDECLENDIMWSDPAKVSGWTANPRGA 357

  Fly   222 GKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAA 286
            ...||.:.|:|..:...|.||.|.||:.|||:.:..|:.|||::|||:|.....|.||:.:::|.
 Worm   358 SVQFGENEVKEMCKLLDIDLIVRGHQVVQDGYEFFAGKKLVTVFSAPHYMQSFTNSAAVCKVSAG 422

  Fly   287 GDYDFKVFEAQ 297
            .:..|:|.:.:
 Worm   423 LEVSFEVLKPE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 101/271 (37%)
MPP_superfamily 12..296 CDD:301300 101/268 (38%)
C23G10.1NP_001367544.1 PP2Ac 162..432 CDD:197547 101/268 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.