DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and R03D7.8

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_496359.2 Gene:R03D7.8 / 174684 WormBaseID:WBGene00010992 Length:596 Species:Caenorhabditis elegans


Alignment Length:268 Identity:76/268 - (28%)
Similarity:126/268 - (47%) Gaps:23/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DRLVENLRHVPVRLP-RELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELG 77
            |.|...:.|.|.:.| ..||:..|....:..:..|.:||.:::...|.|||.|::.||...|:|.
 Worm   316 DLLYRMIEHGPYQYPFTALELLCLFEETAFKMAEEPSLLQIEADITVIGDIRGRYADLHRWLQLT 380

  Fly    78 GSVQEHRYLFLGDLVDRGKN-SVETFLLLAALKVRHPAQVSLLRGNHEC---RSATRSYGFYEEC 138
            |....:|.||||.::|.|:: |||...|:.:||.|.|..|.:|||..|.   |.:||.:    ..
 Worm   381 GWPPHNRILFLGGILDSGESGSVECLALICSLKCRFPKHVFILRGEPETSPFRMSTRLH----PV 441

  Fly   139 LSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIP-----ESG 198
            ::|...:.:.|||..    :|.||||..::|.|:.|.||.::....:..|.|    |     .:.
 Worm   442 ITRAVQSCIKRMCTH----MPFAAIIGKSVLAVYSGFSPMIREKGHIHHLFR----PVTAEHMNA 498

  Fly   199 IIADLLWSDP-QEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLV 262
            :...::::.| .....:..:|...|..||...|:...:|...:::.|.......|:...:...|:
 Worm   499 VERHIIFNQPSNRVRMYRPNPNTEGDWFGKQAVKRACKATRCNVMIRGQSYVPYGYLPCWNNRLI 563

  Fly   263 TIWSAPNY 270
            .:||||.|
 Worm   564 NLWSAPGY 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 76/268 (28%)
MPP_superfamily 12..296 CDD:301300 76/268 (28%)
R03D7.8NP_496359.2 MPP_superfamily 334..595 CDD:387346 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.