DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and F52H3.6

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_496167.1 Gene:F52H3.6 / 174561 WormBaseID:WBGene00009948 Length:329 Species:Caenorhabditis elegans


Alignment Length:289 Identity:114/289 - (39%)
Similarity:167/289 - (57%) Gaps:9/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGD 90
            |...|.::..:....:.:|:.::.::.:|:|..||||||||:.|||.:........:..||||||
 Worm    24 RCINEADIDVVIEKCTKILLAQATMVEVQAPIAVCGDIHGQYTDLLRIFNRCSFPPDQNYLFLGD 88

  Fly    91 LVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVF 155
            .||||:..:|...||.|.|:|:|.:..:|||||||.|..|:||||:||..||..| ::.....:|
 Worm    89 YVDRGRQQLEVICLLMAYKIRYPNRFFILRGNHECASINRTYGFYDECKRRYSLA-LYNDFQNLF 152

  Fly   156 DLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQ-EAPGWAASPR 219
            :.|||.|:|.|.|.|:|||||..:.....|..:.|..:.|.:.:..||||:||: ...|||.|.|
 Worm   153 NHLPLCAMISGRIFCMHGGLSQKLVSWTQLAEITRPFDPPNNSLAMDLLWADPENNMTGWAESSR 217

  Fly   220 GHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            |..::||.|||::||....|.||.|.||:.|||:.:...:.||||:|||.||....|.||::.::
 Worm   218 GVSQIFGADVVKDFTEKMNIDLIARGHQVVQDGYEFFADKRLVTIFSAPKYCGEFDNNAAVMIVD 282

  Fly   285 AAGDYDFKVFEAQALHSKPQPRKPKKRCR 313
            ......|::.       ||..|:.|.:.|
 Worm   283 ERLIVSFEIL-------KPAIREVKIQAR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 111/281 (40%)
MPP_superfamily 12..296 CDD:301300 109/270 (40%)
F52H3.6NP_496167.1 MPP_superfamily 3..294 CDD:301300 109/277 (39%)
PP2Ac 26..295 CDD:197547 109/276 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.