DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp3cc

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_008769035.1 Gene:Ppp3cc / 171378 RGDID:621616 Length:515 Species:Rattus norvegicus


Alignment Length:278 Identity:120/278 - (43%)
Similarity:157/278 - (56%) Gaps:23/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAA 107
            :|..|..:|.:::|..||||:||||.||:.|.|:|||....|||||||.||||..|:|..|.|.:
  Rat    67 ILKQEKTMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWS 131

  Fly   108 LKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVH 172
            ||:.||..:.|||||||||..|..:.|.:||..:| |..|:..|...||.|||||:::...||||
  Rat   132 LKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKY-SELVYEACMHTFDCLPLAALLNQQFLCVH 195

  Fly   173 GGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWAA--------SPRGHGKLFGGDV 229
            ||:||::..|||:|.|||..|.|..|.:.|||||||.|..|...        :.||....|....
  Rat   196 GGMSPEITCLDDIRKLDRFAEPPAFGPVCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPA 260

  Fly   230 VEEFTRANGISLICRAHQLAQDGFRWH-------FGQLLVTIWSAPNYCYRCGNKAAILRLNAAG 287
            |.||.:.|.:..|.|||:....|:|.:       |.. |:||:|||||.....||||:|:     
  Rat   261 VCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPS-LITIFSAPNYLDVYNNKAAVLK----- 319

  Fly   288 DYDFKVFEAQALHSKPQP 305
             |:..|...:..:..|.|
  Rat   320 -YENNVMNIRQFNCSPHP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 120/278 (43%)
MPP_superfamily 12..296 CDD:301300 118/267 (44%)
Ppp3ccXP_008769035.1 MPP_PP2B 37..341 CDD:277361 120/278 (43%)
PP2Ac 54..325 CDD:197547 117/265 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.