DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and Ppp4c

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_599186.1 Gene:Ppp4c / 171366 RGDID:621225 Length:307 Species:Rattus norvegicus


Alignment Length:298 Identity:166/298 - (55%)
Similarity:208/298 - (69%) Gaps:2/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLL 74
            ::|.||.:|.||.  ..|.:|.||:.||....::||.|||:..:.||..|||||||||.||..|.
  Rat     4 ISDLDRQIEQLRR--CELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELF 66

  Fly    75 ELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECL 139
            .:||.|.|..|||:||.||||..||||||||.|||||:|.:::|:|||||.|..|:.||||:|||
  Rat    67 RVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECL 131

  Fly   140 SRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLL 204
            .:|||..|||.|..:||.|.|:|||||.|.||||||||.:|.||.:|::||..|:|..|.:.|||
  Rat   132 RKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLL 196

  Fly   205 WSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPN 269
            ||||::..||..||||.|.|||.|||.:|..||.|.:.||||||..:|::|||.:.::|:|||||
  Rat   197 WSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMTCRAHQLVMEGYKWHFNETVLTVWSAPN 261

  Fly   270 YCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK 307
            |||||||.||||.|:.....||.:|||....::..|.|
  Rat   262 YCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 165/294 (56%)
MPP_superfamily 12..296 CDD:301300 162/283 (57%)
Ppp4cNP_599186.1 PTZ00239 6..307 CDD:173488 166/296 (56%)
MPP_PP2A_PP4_PP6 6..290 CDD:277360 164/285 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.