DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppef1

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031752607.1 Gene:ppef1 / 100496625 XenbaseID:XB-GENE-6037564 Length:700 Species:Xenopus tropicalis


Alignment Length:375 Identity:103/375 - (27%)
Similarity:158/375 - (42%) Gaps:103/375 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PEAMNDADRLVENLR-----HVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQI-VCGDIHG 65
            |..::|.:.|:...:     |....|....|.::..:.|.:::    :|.:..|.:| :|||:||
 Frog   121 PLTVSDTNALLRAFKQGQQLHARYVLQLFHETKKFLKQLPNIV----HLSTSYSKEITICGDLHG 181

  Fly    66 QFEDLLHLLELGG--SVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSA 128
            :.:|||.:....|  |.:.| |||.||||||||||:|..:||....:.:|..|.:.|||||....
 Frog   182 KLDDLLLIFYKNGLPSTENH-YLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIM 245

  Fly   129 TRSYGFYEECLSRY-GSA-NVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDR- 190
            ...|||..|.:.:| |.| |:..:...::..||||.|:|..:|.:|||:. |...||.|.|:|| 
 Frog   246 NLRYGFTNEVIQKYKGHARNILLLLEDIYSRLPLATIVDSKVLILHGGIG-DKTDLDFLSSIDRF 309

  Fly   191 ---------------C---------------------------H--------------------- 192
                           |                           |                     
 Frog   310 KYKSALRTPKTDSEKCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGI 374

  Fly   193 -----------------EIPES-----GIIADLLWSDPQEAPGWAA-SPRGHGKLFGGDVVEEFT 234
                             |:|:|     ..:.|:|||||:...|... |.||.|..||.:|.::..
 Frog   375 LEINYMDSRIQLPDKMPELPDSIRKEWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLL 439

  Fly   235 RANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLN 284
            ......::.|:|:..|:|:.......:|||:||.||.....|:.|.|:|:
 Frog   440 AKYNFKMLIRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 102/370 (28%)
MPP_superfamily 12..296 CDD:301300 102/370 (28%)
ppef1XP_031752607.1 MPP_superfamily 121..500 CDD:417454 103/375 (27%)
FRQ1 535..683 CDD:227455
EF-hand_7 616..684 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.