DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp3cb

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_012813808.1 Gene:ppp3cb / 100037840 XenbaseID:XB-GENE-949827 Length:531 Species:Xenopus tropicalis


Alignment Length:295 Identity:124/295 - (42%)
Similarity:166/295 - (56%) Gaps:24/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGD 90
            ||..|..:| :.|..:.:|..|..:|.:::|..|||||||||.||:.|.|:||:....|||||||
 Frog    77 RLEEEAALR-IIREGAAILRQEKTMLEVEAPITVCGDIHGQFFDLMKLFEVGGTPHNTRYLFLGD 140

  Fly    91 LVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVF 155
            .||||..|:|..|.|.:||:.||..:.|||||||||..|..:.|.:||..:| |..|:..|...|
 Frog   141 YVDRGYFSIECVLYLWSLKIIHPKTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDSCMDAF 204

  Fly   156 DLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDPQEAPGWAA---- 216
            |.|||||:::...|||||||||::..|||:|.|||..|.|..|.:.|||||||.|..|...    
 Frog   205 DCLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPAEDYGSEKTLEH 269

  Fly   217 ----SPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWH-------FGQLLVTIWSAPNY 270
                :.||....:....|.||.::|.:..:.|||:....|:|.:       |.. |:||:|||||
 Frog   270 FTHNTVRGCSYFYSYPAVCEFLQSNNLLSVIRAHEAQDAGYRMYRKSQTTGFPS-LITIFSAPNY 333

  Fly   271 CYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQP 305
            .....||||:|:      |:..|...:..:..|.|
 Frog   334 LDVYNNKAAVLK------YENNVMNIRQFNCSPHP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 124/295 (42%)
MPP_superfamily 12..296 CDD:301300 122/284 (43%)
ppp3cbXP_012813808.1 MPP_PP2B 63..367 CDD:277361 124/295 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.