DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11597 and ppp4ca

DIOPT Version :9

Sequence 1:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001103884.1 Gene:ppp4ca / 100003080 ZFINID:ZDB-GENE-030131-4433 Length:311 Species:Danio rerio


Alignment Length:296 Identity:166/296 - (56%)
Similarity:208/296 - (70%) Gaps:2/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLEL 76
            |.||.:|.||.  ..|.:|.||:.||....::||.|||:.|:.||..|||||||||.||..|..:
Zfish    10 DLDRQIEQLRR--CELIKENEVKALCAKAREILVEESNVQSVDSPVTVCGDIHGQFYDLKELFRV 72

  Fly    77 GGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSR 141
            ||.|.|..|||:||.||||..||||||||.|||||:|.:::|:|||||.|..|:.|||::||..:
Zfish    73 GGEVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFFDECHRK 137

  Fly   142 YGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWS 206
            ||||.|||.|..:||.|.|:||:||.|.||||||||.:|.||.:|::||..|:|..|.:.|||||
Zfish   138 YGSATVWRYCTEIFDYLSLSAIVDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWS 202

  Fly   207 DPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYC 271
            ||::..||..||||.|.|||.|||.:|..||.||:|||||||..:|::|||...::|:|||||||
Zfish   203 DPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDISMICRAHQLVMEGYKWHFNDTVLTVWSAPNYC 267

  Fly   272 YRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRK 307
            |||||.||||.|:.....:|.:|||....::..|.|
Zfish   268 YRCGNVAAILELDEHLQKEFIIFEAAPQETRGLPSK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 165/294 (56%)
MPP_superfamily 12..296 CDD:301300 162/283 (57%)
ppp4caNP_001103884.1 PTZ00239 10..311 CDD:173488 166/296 (56%)
MPP_PP2A_PP4_PP6 10..294 CDD:277360 164/285 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.