DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and OXNAD1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005265616.1 Gene:OXNAD1 / 92106 HGNCID:25128 Length:385 Species:Homo sapiens


Alignment Length:340 Identity:69/340 - (20%)
Similarity:130/340 - (38%) Gaps:82/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ARIVESNFVPLAVGVVAVLAGAL------IVHYLLNK--KSTKPRREPNRTARL--RTLV----- 51
            |.::....:..:||.:.:.|.:|      :.|..|..  ||.:......|||.:  |.:|     
Human    77 AAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKV 141

  Fly    52 ------DPNDKYLLPLIEKENLSHDTRRF-RFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYT 109
                  .|:.|.|..|:..::.|....:: .|.:|....|.|..:.....|:             
Human   142 CGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLL------------- 193

  Fly   110 PISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIK 174
                 |....::|.||.   .:||  ||   :..| ....|..:::.|        :|...|.  
Human   194 -----EQERVIELAVKY---TNHP--PA---LWVH-NTCTLDCEVAVR--------VGGEFFF-- 234

  Fly   175 KLRKDPPKHVTAKRVNMIAGGTGITPMLQLAR--------EVLKRSDKDKTELALLFANQSEKDI 231
                ||.....::.:.:||||.||.|:|.:.|        :..||:..:...:.|.::.::..::
Human   235 ----DPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSEL 295

  Fly   232 LLRAELDELAQKHPDQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGE 296
            |.:..:.:|..:.|::......|.|....|       ||....: ...|.:.:..::.|:   .:
Human   296 LFKKNILDLVNEFPEKIACSLHVTKQTTQI-------NAELKPY-ITEGRITEKEIRDHI---SK 349

  Fly   297 DTLCLLCGPPPMVNY 311
            :||..:||||||.::
Human   350 ETLFYICGPPPMTDF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 56/281 (20%)
cyt_b5_reduct_like 59..330 CDD:99780 52/262 (20%)
OXNAD1XP_005265616.1 FNR_like 148..382 CDD:99778 55/269 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.