DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and CYC2

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_014680.2 Gene:CYC2 / 854202 SGDID:S000005563 Length:366 Species:Saccharomyces cerevisiae


Alignment Length:355 Identity:70/355 - (19%)
Similarity:120/355 - (33%) Gaps:113/355 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSH----DTR 72
            |.||.|:    :.:.:...:::..|....|:              |.:    |..:||    |:.
Yeast    37 LTVGAVS----SYLTYRYTSERENKHELSPS--------------YFV----KYKISHKRDIDSS 79

  Fly    73 RFRFGL----PSKQHVLGLPVGQHIHLIATIDNE-LIIRPYTPI---------------SSDEDV 117
            .|...:    ..|.::..|...:::..:.....| :::|.|||:               ..|...
Yeast    80 HFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNAD 144

  Fly   118 GYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGP---------------SGRLQYLG 167
            |.:...:|.|         ..|::.:.|..|..|..|..|||               |....|:.
Yeast   145 GKLSFYIKKY---------ENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNELKRSRDCLYMD 200

  Fly   168 NGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLA------REVLK--RSDKDKTELALLFA 224
            |.......:|::.........:.|...||||...|||.      |..:|  .:||:..:|..|: 
Yeast   201 NRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTALQLLLTESPFRGTIKLFHTDKNIKQLGPLY- 264

  Fly   225 NQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAI---------KRMPRMGNARFVAWSYNTG 280
                 .||||     |...:..|.||:.|..:..:.:         |..|..|...|       .
Yeast   265 -----PILLR-----LQASNRVQLKIFETDRQTKQDVLKSIQKSITKPYPYKGLLPF-------S 312

  Fly   281 HVNDDMMQQHLYPPGEDTLCLLCGPPPMVN 310
            :||:    :::.|    .|.|:|||...::
Yeast   313 NVNN----KNIMP----VLALVCGPESYIS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 64/316 (20%)
cyt_b5_reduct_like 59..330 CDD:99780 63/308 (20%)
CYC2NP_014680.2 cyt_b5_reduct_like 68..365 CDD:99780 62/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.