DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and MCR1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_012772.1 Gene:MCR1 / 853707 SGDID:S000001633 Length:302 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:108/338 - (31%)
Similarity:167/338 - (49%) Gaps:59/338 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYL-LPLIEKENLSHD 70
            |..:|:|:|.||: |.|...::....:.:....|.|:..:      .:||:: ||:.:.|..|||
Yeast    10 SKALPIALGTVAI-AAATAFYFANRNQHSFVFNESNKVFK------GDDKWIDLPISKIEEESHD 67

  Fly    71 TRRFRFGLPSKQHVLGLPVGQHIHL-IATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPK 134
            ||||.|.||::...:||.:...:.. ..|.....::|||||:|.....|:..||||.|       
Yeast    68 TRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVSDLSQKGHFQLVVKHY------- 125

  Fly   135 FPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGIT 199
              .|||||.||..|:..|.:||:||             |.|.:..|.:.   |.:.::..||||.
Yeast   126 --EGGKMTSHLFGLKPNDTVSFKGP-------------IMKWKWQPNQF---KSITLLGAGTGIN 172

  Fly   200 PMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAIKRM 264
            |:.|||..::: :..|||::.||:.|::.:|||||.|||.|.:|:||:|.:.|.||...:   ..
Yeast   173 PLYQLAHHIVE-NPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQD---DQ 233

  Fly   265 PRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVN-YT-----------CIPGL 317
            ...|...|         ::.|.:|:|:..|.|.|...:|||||.:| |:           .|..|
Yeast   234 DFDGEISF---------ISKDFIQEHVPGPKESTHLFVCGPPPFMNAYSGEKKSPKDQGELIGIL 289

  Fly   318 ERLGHRAEQRFSY 330
            ..||:..:|.|.:
Yeast   290 NNLGYSKDQVFKF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 98/292 (34%)
cyt_b5_reduct_like 59..330 CDD:99780 96/283 (34%)
MCR1NP_012772.1 cyt_b5_reduct_like 56..302 CDD:99780 96/283 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54129
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.