DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and AT5G20080

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_568391.1 Gene:AT5G20080 / 832130 AraportID:AT5G20080 Length:328 Species:Arabidopsis thaliana


Alignment Length:354 Identity:115/354 - (32%)
Similarity:169/354 - (47%) Gaps:96/354 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVGVVAVLAGALIVHYLLN----------KKSTKPRREPNRTARLRTLVDPNDKYL-LPLIEKEN 66
            :.|.:|.|:|....:||.:          |:.|.|          :|.::| ||:| ..|.:...
plant    35 STGAIAALSGGFSYYYLTSGNNLVYLDQAKEETGP----------KTALNP-DKWLEFKLQDTAR 88

  Fly    67 LSHDTRRFRFGL-PSKQHVLGL----------PVGQHIHLIATIDNELIIRPYTPISSDEDVGYV 120
            :||:|:.|||.. ||.:  |||          |:|.:    |....:.:||||||||..|..||.
plant    89 VSHNTQLFRFSFDPSAE--LGLHVASCLLTRAPLGYN----AEGKTKYVIRPYTPISDPEAKGYF 147

  Fly   121 DLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVT 185
            ||::|||         ..|||:||...|:.||.:..:||..:.:|..|                .
plant   148 DLLIKVY---------PDGKMSQHFASLKPGDVLEVKGPVEKFKYSPN----------------M 187

  Fly   186 AKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKI 250
            .|.:.|||||:|||||||:...::| :.:|.|:::||:||.|..||||:.:||.|...||: .||
plant   188 KKHIGMIAGGSGITPMLQVIDAIVK-NPEDNTQISLLYANVSPDDILLKQKLDVLQANHPN-LKI 250

  Fly   251 WYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIP 315
            :||||...:              .|....|:::.||..:.|..|.:|||.|:||||.|:.:  |.
plant   251 FYTVDNPTK--------------NWKGGVGYISKDMALKGLPLPTDDTLILVCGPPGMMEH--IS 299

  Fly   316 G--------------LERLGHRAEQRFSY 330
            |              |:.||:..|..|.:
plant   300 GGKAPDWSQGEVKGILKELGYTEEMVFKF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 105/304 (35%)
cyt_b5_reduct_like 59..330 CDD:99780 101/295 (34%)
AT5G20080NP_568391.1 cyt_b5_reduct_like 81..328 CDD:99780 101/295 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I1515
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.