DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Cyb5r1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_082333.1 Gene:Cyb5r1 / 72017 MGIID:1919267 Length:305 Species:Mus musculus


Alignment Length:319 Identity:163/319 - (51%)
Similarity:223/319 - (69%) Gaps:26/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRF 76
            |.||::.:| |..:..||: ::|.:|:         .||.||::||||.|::|..:||:||||||
Mouse    13 LGVGLLTLL-GLALGTYLV-RRSRRPQ---------VTLQDPDEKYLLRLLDKTTVSHNTRRFRF 66

  Fly    77 GLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKM 141
            .||:..|:||||||:|::|.|.||..|:||||||::||||.||||||:|||.|..|||||.||||
Mouse    67 ALPTAHHILGLPVGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKM 131

  Fly   142 TQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAR 206
            :|:|:.|::||.:.||||||.|.|.|.|.|:|:..:|.||:...||::.||||||||||||||.|
Mouse   132 SQYLDSLKIGDMVEFRGPSGLLSYAGKGNFNIQPNKKSPPELRVAKKLGMIAGGTGITPMLQLIR 196

  Fly   207 EVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAIKRMPRMGNAR 271
            .:|| ..:|.|:..||||||:|:||:||.:|:||..::|::||:|:|:|...|            
Mouse   197 AILK-VPEDPTQCFLLFANQTERDIILREDLEELQAQYPNRFKLWFTLDSPPE------------ 248

  Fly   272 FVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIPGLERLGHRAEQRFSY 330
              .|:|:.|.|..||:|:||..|.||.|.|||||||||...|.|.|::||:..:.||:|
Mouse   249 --DWTYSKGFVTADMIQEHLPAPAEDVLLLLCGPPPMVQLACHPNLDKLGYSQKMRFTY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 151/278 (54%)
cyt_b5_reduct_like 59..330 CDD:99780 146/270 (54%)
Cyb5r1NP_082333.1 PTZ00319 33..305 CDD:173521 155/295 (53%)
cyt_b5_reduct_like 49..305 CDD:99780 146/270 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4982
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 334 1.000 Inparanoid score I2396
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54129
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm44164
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2205
SonicParanoid 1 1.000 - - X606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.