DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Cyb5rl

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_038967057.1 Gene:Cyb5rl / 689035 RGDID:1597451 Length:339 Species:Rattus norvegicus


Alignment Length:280 Identity:75/280 - (26%)
Similarity:112/280 - (40%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHL 95
            |..|....::|..:....|.:.|.......:...|.::.||...||.||...| |||..|||:.|
  Rat    52 NDMSLLSGKQPPESQGCSTKLSPETFLAFHISTMEKVTRDTYLVRFTLPGNCH-LGLLPGQHLIL 115

  Fly    96 IATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPS 160
            ...:|:..|.|.|||||.....||.|:::|.|         ..|.|::::|....||...:|||.
  Rat   116 RGVVDDLEIQRAYTPISPATAQGYFDVLIKCY---------ETGLMSRYVESWRPGDTAFWRGPF 171

  Fly   161 GRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFAN 225
            |...|             :|.|:   ..:.|:|.|||:.||:.:.:.:....| |:|.:.|:...
  Rat   172 GSFLY-------------EPKKY---GELLMLAAGTGLAPMVPIVQSITDNED-DETFVTLVGCF 219

  Fly   226 QSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAIKRMPRMGNAR--FV-----AWSYNTGHVN 283
            ::.:||.|:....|       |.:.|                 |.|  ||     .|:..||...
  Rat   220 KTFEDIYLKTFFQE-------QARFW-----------------NVRTFFVLSQPWPWTLITGTKR 260

  Fly   284 DDMMQQHLYPPGEDTLCLLC 303
            .....|..:.||. .|.|.|
  Rat   261 SPDQSQTTWSPGL-ALLLTC 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 71/260 (27%)
cyt_b5_reduct_like 59..330 CDD:99780 70/252 (28%)
Cyb5rlXP_038967057.1 Oxidored-like 16..51 CDD:401663
cyt_b5_reduct_like 82..>257 CDD:99780 62/225 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.