DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and oxnad1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005170097.1 Gene:oxnad1 / 558500 ZFINID:ZDB-GENE-060503-199 Length:306 Species:Danio rerio


Alignment Length:257 Identity:57/257 - (22%)
Similarity:102/257 - (39%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 HIHLIATIDN--ELIIRPYTPISSDEDVGYVDLVVKVYFKDSHP--KFPAGGKMTQHLEQLELGD 152
            |:...|::..  ||.......|.|:.|.     |.::..:.:||  .|.||..:...:..::...
Zfish    45 HLERTASVHRQMELFSARVCDIISESDT-----VKRLRLEVAHPDFSFRAGQWVDFFIPGVDTVG 104

  Fly   153 KISFRGPSGRLQYLGNGTFSIKKLRKDPPKH----------VTAKRVN----------------- 190
            ..|.....|.|:..|....::|..| .||.|          ..|.||.                 
Zfish   105 GFSICSSPGLLKREGVIELAVKYAR-HPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLL 168

  Fly   191 MIAGGTGITPMLQL---AREVLKRSDKDK-----TELALLFANQSEKDILLRAELDELAQKHPDQ 247
            ::|||.||.|:..:   |.::.:.:...:     |.|.....|.:|  :|.:..:.::..:.||:
Zfish   169 LVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTE--LLFKDTIIDICHERPDK 231

  Fly   248 FKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMV 309
            |...:.|.:.:..|:...:....|        |.::.:.:|:::.|  |.|||.|||||||:
Zfish   232 FSCHFHVTQQSSDIEPQLQPYTIR--------GRISAEELQRYVDP--ERTLCYLCGPPPMI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 57/257 (22%)
cyt_b5_reduct_like 59..330 CDD:99780 57/257 (22%)
oxnad1XP_005170097.1 Mcr1 60..286 CDD:223617 53/242 (22%)
FNR_like 70..303 CDD:99778 51/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.