DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and cyb5r4

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005173509.1 Gene:cyb5r4 / 553685 ZFINID:ZDB-GENE-050522-225 Length:577 Species:Danio rerio


Alignment Length:274 Identity:78/274 - (28%)
Similarity:135/274 - (49%) Gaps:61/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TLVDPNDKYLL----PLIEKENLSHDTRRFRFGLP--SKQHVLGLPVGQHIHLIATIDNELIIRP 107
            |.:...|:.|.    .|:.|.:::|:|:..|..||  |:..|   |||:|::|..::....:::|
Zfish   322 TFIQCKDRGLFYRECVLLSKTDVTHNTQLLRLQLPPGSRMQV---PVGRHVYLKTSVQGTDVVKP 383

  Fly   108 YT--------PISSDEDVGY-VDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRL 163
            ||        |..|..:||. :.|::|||         ..|.:|.|:..|.:|..:|..||.|.|
Zfish   384 YTAVDQMLIPPSQSSAEVGSDIHLMIKVY---------PDGVLTPHIANLPIGASLSVGGPEGSL 439

  Fly   164 QYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSE 228
                    :::.||     .||  .:.|:|.|||.|||.:|.|..|:.....: ::.|:|.|:.|
Zfish   440 --------TLRVLR-----DVT--HLYMLAAGTGFTPMARLIRLALQEFTVIR-KMKLMFFNRQE 488

  Fly   229 KDILLRAELDELAQKHPDQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYP 293
            :|||.:::||||..|. ::|::.:.:.:..:              :|:...|.::..|:|..|..
Zfish   489 RDILWQSQLDELCTKE-ERFEVQHVLSEPAD--------------SWTGRRGRIDACMLQNFLER 538

  Fly   294 PGEDTLCL--LCGP 305
            | |::.||  :|||
Zfish   539 P-ENSKCLVCVCGP 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 77/272 (28%)
cyt_b5_reduct_like 59..330 CDD:99780 75/264 (28%)
cyb5r4XP_005173509.1 Cyt-b5 108..180 CDD:278597
p23_NCB5OR 228..314 CDD:107240
cyt_b5_reduct_like 336..575 CDD:99780 75/260 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.