DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and CYB5R1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_057327.2 Gene:CYB5R1 / 51706 HGNCID:13397 Length:305 Species:Homo sapiens


Alignment Length:319 Identity:164/319 - (51%)
Similarity:224/319 - (70%) Gaps:26/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRF 76
            |.||:|.:| |..:..||: ::|.:|:         .||:|||:||||.|::|..:||:|:||||
Human    13 LGVGLVTLL-GLAVGSYLV-RRSRRPQ---------VTLLDPNEKYLLRLLDKTTVSHNTKRFRF 66

  Fly    77 GLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKM 141
            .||:..|.||||||:||:|...||..|:||||||::||||.||||||:|||.|..|||||.||||
Human    67 ALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKM 131

  Fly   142 TQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAR 206
            :|:|:.|::||.:.||||||.|.|.|.|.|:|:..:|.||:...||::.||||||||||||||.|
Human   132 SQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIR 196

  Fly   207 EVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAIKRMPRMGNAR 271
            .:|| ..:|.|:..||||||:||||:||.:|:||..::|::||:|:|:|       ..|:     
Human   197 AILK-VPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLD-------HPPK----- 248

  Fly   272 FVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIPGLERLGHRAEQRFSY 330
              .|:|:.|.|..||:::||..||:|.|.|||||||||...|.|.|::||:..:.||:|
Human   249 --DWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 151/278 (54%)
cyt_b5_reduct_like 59..330 CDD:99780 145/270 (54%)
CYB5R1NP_057327.2 PLN02252 <38..300 CDD:215141 151/276 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3780
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 336 1.000 Inparanoid score I2404
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm42109
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2205
SonicParanoid 1 1.000 - - X606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.