DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and CYB5R4

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_057314.2 Gene:CYB5R4 / 51167 HGNCID:20147 Length:521 Species:Homo sapiens


Alignment Length:331 Identity:89/331 - (26%)
Similarity:145/331 - (43%) Gaps:91/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIVESNFVPLAVGVVAVL-------AGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLP 60
            |:|||      ||.:.::       :...:.|.|.|..|..||::.....|           ...
Human   232 RVVES------VGKIEIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYR-----------KCQ 279

  Fly    61 LIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSD------EDV-- 117
            ||.||:::||||.|...||...| |.:|:|||::|...|....|::||||:|..      |.|  
Human   280 LISKEDVTHDTRLFCLMLPPSTH-LQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLP 343

  Fly   118 --GYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDP 180
              .|:..::|:|        |. |..|..|::|::||.:|...|        .|.|.|.|.::  
Human   344 NNKYIYFLIKIY--------PT-GLFTPELDRLQIGDFVSVSSP--------EGNFKISKFQE-- 389

  Fly   181 PKHVTAKRVNMIAGGTGITPMLQLAREVLKRSD-KDKTELALLFANQSEKDILLRAELDELAQKH 244
                 .:.:.::|.|||.|||:::....|  :| ....::.|:|.|::|.||:.|::|::||.|.
Human   390 -----LEDLFLLAAGTGFTPMVKILNYAL--TDIPSLRKVKLMFFNKTEDDIIWRSQLEKLAFKD 447

  Fly   245 PDQFKIWYTVDKANEAIKRMPRMGNARFV------AWSYNTGHVNDDMMQQHLYP--PGEDTLCL 301
                             ||:    :..||      .|:...||::..::.:.|..  .....|..
Human   448 -----------------KRL----DVEFVLSAPISEWNGKQGHISPALLSEFLKRNLDKSKVLVC 491

  Fly   302 LCGPPP 307
            :|||.|
Human   492 ICGPVP 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 76/276 (28%)
cyt_b5_reduct_like 59..330 CDD:99780 76/268 (28%)
CYB5R4NP_057314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 58..130 CDD:306642
p23_NCB5OR 170..256 CDD:107240 6/29 (21%)
cyt_b5_reduct_like 278..519 CDD:99780 76/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.