DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and CG11257

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_611419.1 Gene:CG11257 / 37227 FlyBaseID:FBgn0034442 Length:535 Species:Drosophila melanogaster


Alignment Length:328 Identity:79/328 - (24%)
Similarity:137/328 - (41%) Gaps:101/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KPRREP---------NR--TARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPS--KQHVLGL 87
            |...||         ||  ::||.     ::.:...::..::.:||:  |...|.|  ::.::.|
  Fly   266 KEEAEPWPTYGTHVSNRLDSSRLH-----DETFEYEVVHSKDFNHDS--FELCLQSVGQKVLMVL 323

  Fly    88 PVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDL-------------VVKVYFKDSHPKFPAGG 139
            |.|.|:.:...::..:|.|.|||:    |..|:.|             ::|.|         ..|
  Fly   324 PAGYHVDIEVPLEGRVIQRSYTPV----DHTYLRLENIRSSRSECLHFLIKRY---------PNG 375

  Fly   140 KMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKR-VNMIAGGTGITPMLQ 203
            .::.||::||.|.::.:..|        .|:|.:..|        ||.| :.::|.|:|:||:|.
  Fly   376 PVSSHLQKLETGSRVHWSAP--------RGSFQLSDL--------TAHRNILLLAAGSGLTPILS 424

  Fly   204 LAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAIKRMPRMG 268
            |.:.:|||:......|.||:.|::.:||.|:.:|.||   |.|                      
  Fly   425 LIQPILKRNTNRIESLQLLYFNKTNEDIWLKEKLHEL---HTD---------------------- 464

  Fly   269 NARFVAWSYNTGHVNDDMMQ----QHLYP------PGEDTLCLLCGPPPMVNYTCIPGLERLGHR 323
            :.||...:|.:  .::|..|    :.|.|      |...|..|:|||... |...:..|.:|..:
  Fly   465 DERFSCTNYVS--QSEDNPQRIALELLAPLFQKNQPERCTYVLICGPSGF-NTAALDILSQLDVK 526

  Fly   324 AEQ 326
            |.|
  Fly   527 ANQ 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 72/302 (24%)
cyt_b5_reduct_like 59..330 CDD:99780 72/294 (24%)
CG11257NP_611419.1 Cyt-b5 90..162 CDD:278597
p23_NCB5OR 190..276 CDD:107240 3/9 (33%)
cyt_b5_reduct_like 295..533 CDD:99780 72/294 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.