DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and cyb5r3

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_997850.1 Gene:cyb5r3 / 324560 ZFINID:ZDB-GENE-030131-3281 Length:298 Species:Danio rerio


Alignment Length:282 Identity:157/282 - (55%)
Similarity:204/282 - (72%) Gaps:15/282 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISS 113
            ||.||:.||.|.|::||.:|||||||||.|.|..||||||:||||:|.|.||..|::|||||:||
Zfish    32 TLEDPDVKYPLRLVDKEIISHDTRRFRFALKSPDHVLGLPIGQHIYLSAKIDGNLVVRPYTPVSS 96

  Fly   114 DEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRK 178
            |:|.|:||||||:|:|:.|||||.||||:|:||.|.:||.|.||||||.|.|.|.|:|:|:..:|
Zfish    97 DDDKGFVDLVVKIYYKNIHPKFPDGGKMSQYLESLRIGDTIDFRGPSGLLVYKGKGSFAIRPDKK 161

  Fly   179 DPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQK 243
            ......|||.|.|||||||||||||:.:.|:| ..||.|...||||||:|||||||.||:|:...
Zfish   162 SDAVIKTAKHVGMIAGGTGITPMLQIIQAVMK-DPKDDTVCYLLFANQTEKDILLRPELEEIMAN 225

  Fly   244 HPDQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPM 308
            ||.:||:|||||:|.:              .|.|:.|.:|:||:::||..||.:||.|:||||||
Zfish   226 HPTRFKLWYTVDRAPD--------------GWEYSQGFINEDMVRKHLPSPGNETLVLMCGPPPM 276

  Fly   309 VNYTCIPGLERLGHRAEQRFSY 330
            :.:.|.|.|:::||..::||.:
Zfish   277 IQFACNPSLDKVGHSNDRRFMF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 155/278 (56%)
cyt_b5_reduct_like 59..330 CDD:99780 151/270 (56%)
cyb5r3NP_997850.1 PTZ00319 23..298 CDD:173521 157/280 (56%)
cyt_b5_reduct_like 42..298 CDD:99780 151/270 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596130
Domainoid 1 1.000 163 1.000 Domainoid score I3917
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 339 1.000 Inparanoid score I2336
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm25221
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2205
SonicParanoid 1 1.000 - - X606
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.