DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Cyb5r4

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_077157.2 Gene:Cyb5r4 / 266690 MGIID:2386848 Length:528 Species:Mus musculus


Alignment Length:263 Identity:79/263 - (30%)
Similarity:133/263 - (50%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPIS----SD--EDV-- 117
            ||.||:::||||.|...||...| |.:|||||::|..::....|::||||:|    ||  |.|  
Mouse   287 LISKEDVTHDTRLFCLMLPPSTH-LQVPVGQHVYLKLSVTGAEIVKPYTPVSDSLLSDFKEPVLS 350

  Fly   118 --GYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDP 180
              .|:..::|:|        || |..|..|::|::||.||..||        .|.|.:.||::  
Mouse   351 PNKYICFLIKIY--------PA-GLFTPELDRLQIGDFISVSGP--------EGDFKVSKLQE-- 396

  Fly   181 PKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHP 245
                 .:.:.::|.|||.|||:.:....|......: ::.|:|.|::|.||:.|.:|::||.:. 
Mouse   397 -----VEDLFLLAAGTGFTPMVTVLNYALSHMSSLR-KVKLMFFNKTEDDIIWRCQLEKLALRE- 454

  Fly   246 DQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDT---LCLLCGPPP 307
            .:|.:.:.:              :|....|:...||::..::.:.|....|::   || :|||.|
Mouse   455 KRFDVEFVL--------------SAPSPEWNGKQGHISRALLSEFLQRSSENSRAFLC-ICGPTP 504

  Fly   308 MVN 310
            ..:
Mouse   505 FTD 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 79/263 (30%)
cyt_b5_reduct_like 59..330 CDD:99780 79/263 (30%)
Cyb5r4NP_077157.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Cyt-b5 56..128 CDD:278597
p23_NCB5OR 177..263 CDD:107240
cyt_b5_reduct_like 285..526 CDD:99780 79/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.