DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Cyb5r3

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006242127.1 Gene:Cyb5r3 / 25035 RGDID:2502 Length:307 Species:Rattus norvegicus


Alignment Length:288 Identity:169/288 - (58%)
Similarity:211/288 - (73%) Gaps:15/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRP 107
            |::...||.:|:.||.|.||:||.:|||||||||.|||.||:||||:||||:|...||..|:|||
  Rat    35 RSSPAITLENPDIKYPLRLIDKEIISHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRP 99

  Fly   108 YTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFS 172
            |||:|||:|.|:|||||||||||:||||||||||:|:||.:.:||.|.||||:|.|.|.|.|.|:
  Rat   100 YTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFA 164

  Fly   173 IKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAEL 237
            |:..:|..|...|.|.|.|||||||||||||:.|.||| ...|.|...||||||||||||||.||
  Rat   165 IRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLK-DPNDHTVCYLLFANQSEKDILLRPEL 228

  Fly   238 DELAQKHPDQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLL 302
            :||..:|..:||:|||||||.:              ||.|:.|.||::|::.||.||||:||.|:
  Rat   229 EELRNEHSSRFKLWYTVDKAPD--------------AWDYSQGFVNEEMIRDHLPPPGEETLILM 279

  Fly   303 CGPPPMVNYTCIPGLERLGHRAEQRFSY 330
            ||||||:.:.|:|.|||:||..|:.|::
  Rat   280 CGPPPMIQFACLPNLERVGHPKERCFTF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 166/278 (60%)
cyt_b5_reduct_like 59..330 CDD:99780 163/270 (60%)
Cyb5r3XP_006242127.1 PTZ00319 22..307 CDD:173521 169/286 (59%)
cyt_b5_reduct_like 51..307 CDD:99780 163/270 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353933
Domainoid 1 1.000 167 1.000 Domainoid score I3772
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 344 1.000 Inparanoid score I2253
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm46255
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X606
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.