DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Cyb5rl

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006503009.1 Gene:Cyb5rl / 230582 MGIID:1919657 Length:445 Species:Mus musculus


Alignment Length:243 Identity:62/243 - (25%)
Similarity:96/243 - (39%) Gaps:47/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHL 95
            |.:|....::|..:......:.|.......:...|.::.||...||.||.... |||..|||:.|
Mouse   117 NDRSLLSGKQPPESQSCSAKLSPETFLAFHISTMEKVTKDTYLVRFTLPGNSR-LGLRPGQHLIL 180

  Fly    96 IATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPS 160
            ...:|...|.|.|||||.....||.|:::|.|         ..|.|:|::|....||...:|||.
Mouse   181 RGVVDGLEIQRAYTPISPVTAEGYFDVLIKCY---------RTGLMSQYVESWRTGDTAFWRGPF 236

  Fly   161 GRLQYLGNGTFSIKKLRKDP------------PKHVTAKRVN-------------------MIAG 194
            |...|...     |:....|            |:|...:|..                   |:|.
Mouse   237 GSFLYEPK-----KEATCSPHSLLDWKALALSPQHAFPERAGRFSSAASRLGRSPVYGELLMLAA 296

  Fly   195 GTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQ 242
            |||:.||:.:.:.:....| |:|.:.|:...::.:.|.|:....|.|:
Mouse   297 GTGLAPMVPILQSITDDED-DETFVTLVGCFKTFEGIYLKTFFQEQAR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 59/223 (26%)
cyt_b5_reduct_like 59..330 CDD:99780 58/215 (27%)
Cyb5rlXP_006503009.1 Oxidored-like 77..116 CDD:370696
cyt_b5_reduct_like 147..>355 CDD:99780 58/213 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.