DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Oxnad1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_663435.2 Gene:Oxnad1 / 218885 MGIID:1916953 Length:311 Species:Mus musculus


Alignment Length:317 Identity:64/317 - (20%)
Similarity:118/317 - (37%) Gaps:58/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVGVVAVLAG-----ALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTR 72
            :||.|...|.     |..:.:|......|.||:.:...|..:::.........:.|..:.|...:
Mouse    14 SVGAVCTQAASWGLKASTLRHLTLASIIKSRRKTDHLERTASVLRREVMAAAKVCEITHESPSVK 78

  Fly    73 RFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDV---GYVDLVVKVYFKDSHPK 134
            ..|..:..|.  .....||.:...  |....::..::..||.:.:   ..::|.||  :.|..|.
Mouse    79 SLRLLVADKD--FSFKAGQWVDFF--IPGVSVVGGFSICSSPQRLERDRIIELAVK--YADHPPA 137

  Fly   135 FPAGGKMTQHLE-QLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGI 198
            .....|.|...| .|.:|.:..|                      ||......:.:.:||||.||
Mouse   138 VWVHNKCTLDSEVALRVGGEFFF----------------------DPQPTDAPRNLILIAGGVGI 180

  Fly   199 TPMLQLAREV--LKRSDKDKTE------LALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVD 255
            .|:|.:.|..  |.|...||..      :.|.::.::..::|.:.::.:|..:.|::....:.|.
Mouse   181 NPLLSILRHSADLHRDHADKGRSYEIGTVKLFYSAKNTSELLFKKDILDLVHEFPEKISCSFHVT 245

  Fly   256 KANEAIKRMPRMGNARFVAWSYNT-GHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNY 311
            |....|....:         .|.| |.:.:..::.|:   ..:||..:||||||.::
Mouse   246 KQTAQISAELK---------PYVTDGRITEKEIRDHI---SAETLFYVCGPPPMTDF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 54/274 (20%)
cyt_b5_reduct_like 59..330 CDD:99780 54/266 (20%)
Oxnad1NP_663435.2 FNR_like 69..308 CDD:99778 54/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.