DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Y52B11A.3

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001379343.1 Gene:Y52B11A.3 / 173002 WormBaseID:WBGene00013123 Length:540 Species:Caenorhabditis elegans


Alignment Length:304 Identity:67/304 - (22%)
Similarity:127/304 - (41%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQH-VLGLPVGQHI 93
            :::...|.:|.|..|.....::|           :..|:|||..|...||  :| ...:|:|.|:
 Worm   274 IDRSKCKIQRRPGVTYHTTEIID-----------RYRLNHDTLIFSLQLP--EHTTYRIPIGHHV 325

  Fly    94 HLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRG 158
            .:.....|.::.|||||| |:.|...:|.::|:|         :.|..|..||.|::|.::....
 Worm   326 SIKIRKGNSVLYRPYTPI-SNPDPQKIDFMIKIY---------SNGICTPSLENLKIGGELEISD 380

  Fly   159 PSGR---LQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELA 220
            |.|.   .::..|                 |:.:.::|.|:|||||:.:..:.:::::...:::.
 Worm   381 PIGERNFAEWTEN-----------------AQELILLAAGSGITPMIDIMEKRIQKTENSNSKVY 428

  Fly   221 LLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAI--KRMPRMGNARFVAWSYNTGHVN 283
            .|..|::|.|  |:....|...|...:...:|:..:.:|.|  |.:............|..|.|:
 Worm   429 FLMFNKTEND--LQTGKPEENPKSTWKMADFYSKYRGDERIVMKNVLSASECPVETGEYFNGRVS 491

  Fly   284 DDMMQQHLYPPG-EDTLCLLCGPPPMVNYTCIPGLERLGHRAEQ 326
            .|::...:.... ......:|||...: ......||.|...::|
 Worm   492 TDLLNSIISTSSTASRRAFICGPDGFI-LAAKTALESLNLHSDQ 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 63/283 (22%)
cyt_b5_reduct_like 59..330 CDD:99780 62/275 (23%)
Y52B11A.3NP_001379343.1 Cyt-b5 61..127 CDD:395121
cyt_b5_reduct_like 293..538 CDD:99780 63/285 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.