DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and CYB5R3

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001165131.1 Gene:CYB5R3 / 1727 HGNCID:2873 Length:334 Species:Homo sapiens


Alignment Length:282 Identity:164/282 - (58%)
Similarity:205/282 - (72%) Gaps:15/282 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISS 113
            ||..|:.||.|.||::|.:|||||||||.|||.||:|||||||||:|.|.||..|::||||||||
Human    68 TLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISS 132

  Fly   114 DEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRK 178
            |:|.|:||||:||||||:||||||||||:|:||.:::||.|.||||||.|.|.|.|.|:|:..:|
Human   133 DDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKK 197

  Fly   179 DPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQK 243
            ..|...|.|.|.|||||||||||||:.|.::|..| |.|...||||||:|||||||.||:||..|
Human   198 SNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPD-DHTVCHLLFANQTEKDILLRPELEELRNK 261

  Fly   244 HPDQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPM 308
            |..:||:|||:|:|.|              ||.|..|.||::|::.||.||.|:.|.|:||||||
Human   262 HSARFKLWYTLDRAPE--------------AWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPM 312

  Fly   309 VNYTCIPGLERLGHRAEQRFSY 330
            :.|.|:|.|:.:||..|:.|.:
Human   313 IQYACLPNLDHVGHPTERCFVF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 162/278 (58%)
cyt_b5_reduct_like 59..330 CDD:99780 159/270 (59%)
CYB5R3NP_001165131.1 PTZ00319 44..334 CDD:173521 164/280 (59%)
cyt_b5_reduct_like 78..334 CDD:99780 159/270 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159868
Domainoid 1 1.000 170 1.000 Domainoid score I3780
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 336 1.000 Inparanoid score I2404
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm42109
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2205
SonicParanoid 1 1.000 - - X606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.