DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and Cyb5r3

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006520345.2 Gene:Cyb5r3 / 109754 MGIID:94893 Length:320 Species:Mus musculus


Alignment Length:330 Identity:173/330 - (52%)
Similarity:224/330 - (67%) Gaps:21/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARIVESNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKE 65
            :|.:...:.:||.:.:..|:...:...|.|..|..:      |:....||.:|:.||.|.||:||
Mouse    12 IAGLARRSGLPLCLFLSHVVLSPVWFIYSLFMKLFQ------RSTPAITLENPDIKYPLRLIDKE 70

  Fly    66 NLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKD 130
            .:|.|||||||.|||.||:||||:||||:|...||..|:||||||:|||:|.|:|||||||||||
Mouse    71 VISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKD 135

  Fly   131 SHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGG 195
            :||||||||||:|:||.:::||.|.||||:|.|.|.|.|.|:|:..:|..|...|.|.|.|||||
Mouse   136 THPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGG 200

  Fly   196 TGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEA 260
            ||||||||:.|.||| ...|.|...||||||||||||||.||:||..:|..:||:|||||||.: 
Mouse   201 TGITPMLQVIRAVLK-DPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVDKAPD- 263

  Fly   261 IKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIPGLERLGHRAE 325
                         ||.|:.|.||::|::.||..|||:.|.|:||||||:.:.|:|.|||:||..|
Mouse   264 -------------AWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKE 315

  Fly   326 QRFSY 330
            :.|::
Mouse   316 RCFTF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 163/278 (59%)
cyt_b5_reduct_like 59..330 CDD:99780 160/270 (59%)
Cyb5r3XP_006520345.2 PLN02252 <33..320 CDD:215141 169/307 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850238
Domainoid 1 1.000 134 1.000 Domainoid score I4982
eggNOG 1 0.900 - - E1_COG0543
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 334 1.000 Inparanoid score I2396
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm44164
orthoMCL 1 0.900 - - OOG6_100179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2205
SonicParanoid 1 1.000 - - X606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.