DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and cyb5r1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_031752214.1 Gene:cyb5r1 / 100488016 XenbaseID:XB-GENE-946788 Length:247 Species:Xenopus tropicalis


Alignment Length:240 Identity:118/240 - (49%)
Similarity:163/240 - (67%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLG 86
            |.||:|                ..:..||:|||.||.|.||.|..::|:|||.||.||:..|.||
 Frog    14 GCLILH----------------KRKYVTLLDPNKKYKLRLIYKSVINHNTRRMRFALPTVFHTLG 62

  Fly    87 LPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELG 151
            ||.|:|::::|.|:..|::|||||:|:|::.||||||:|:||:..||.||.||||:|:|:.|.:|
 Frog    63 LPAGKHVYILAKINGSLVVRPYTPVSTDDERGYVDLVIKIYFRGQHPTFPEGGKMSQYLDNLSIG 127

  Fly   152 DKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDK 216
            |.|.|:||.|.|.|.|.|.|.|:..:|.|.:...|::|.||||||||||||||.:.:||..| |.
 Frog   128 DVIEFQGPRGLLAYNGKGEFGIQINKKSPVEKKFARQVGMIAGGTGITPMLQLIQTILKDPD-DL 191

  Fly   217 TELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAI 261
            |:.:|||||:|:.||:||.||.||.:||..:||:|:.|:.|.|.:
 Frog   192 TKCSLLFANKSKNDIILREELQELERKHSGRFKVWFAVETAPEGM 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 112/211 (53%)
cyt_b5_reduct_like 59..330 CDD:99780 107/203 (53%)
cyb5r1XP_031752214.1 PLN02252 <24..235 CDD:215141 113/211 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54129
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm49339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.